ALDH7A1 antibody orb381040 from Biorbyt

Product Specs
ItemALDH7A1 antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb381040
Quantity10 µg, 100 µg
ApplicationsFC, ICC, IF, IHC, IHC-Fr, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetALDH7A1
IsotypeRabbit IgG
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids
NCBI Full Gene Namealdehyde dehydrogenase 7 family member A1
NCBI Gene AliasesATQ1, EPD, PDE
ClonalityPolyclonal
HostRabbit
Molecular Weight58487 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Rat, By Heat Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Human Immunocytochemistry/Immunofluorescence, 2µg/ml, Human Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List